> Products > Catalog Peptides > Defensins >

HNP - 1, Defensin Human Neutrophil Peptide - 1 Syn-60773

Product Name  
HNP - 1, Defensin Human Neutrophil Peptide - 1
 
Catalog Syn-60773
Sequence
(One-Letter Code)
ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
Sequence
(Three-Letter Code)
H - Ala - Cys - Tyr - Cys - Arg - Ile - Pro - Ala - Cys - Ile - Ala - Gly - Glu - Arg - Arg - Tyr - Gly - Thr - Cys - Ile - Tyr - Gln - Gly - Arg - Leu - Trp - Ala - Phe - Cys - Cys - OH (Disulfide bridge: 2 - 30, 4 - 19, 9 - 29)
Molecular Weight 3442.1
Description Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.
Storage -20°C


Previous : hBD - 4, β - Defensin - 4, human Syn-60772 Next : HNP - 2, Defensin Human Neutrophil Peptide - 2 Syn-60774

Click here to leave a message