> Products > Catalog Peptides > Defensins >

hBD - 3, β - Defensin - 3, human Syn-60771

Product Name  
hBD - 3, β - Defensin - 3, human
 
Catalog Syn-60771
Sequence
(One-Letter Code)
GIINTLQKYYCRVRGGRCAVLSCLPKEEQIGKCSTRGRKCCRRKK (Disulfide bridge: 11-40, 18-33, 23-41)
Sequence
(Three-Letter Code)
H - Gly - Ile - Ile - Asn - Thr - Leu - Gln - Lys - Tyr - Tyr - Cys - Arg - Val - Arg - Gly - Gly - Arg - Cys - Ala - Val - Leu - Ser - Cys - Leu - Pro - Lys - Glu - Glu - Gln - Ile - Gly - Lys - Cys - Ser - Thr - Arg - Gly - Arg - Lys - Cys - Cys - Arg - Arg - Lys - Lys - OH (Disulfide bridge: 11 - 40, 18 - 33, 23 - 41)
Molecular Weight 5155.2
Description This is a 5.1kDa 45-amino acid antimicrobial peptide called beta-Defensin-3 (hBD-3) having a beta sheet with three intramolecular disulfide bonds. It is expressed in high levels in keratinocytes and tonsilar tissue while expressed low in epithelia of the respiratory, gastrointestinal and genito-urinary tracts. Factors that induce its expression include TNF-alpha, IL-1beta and bacteria such as P. aeruginosa and S. aureus. hBD-3 is also potentially induced after exposure to IFN-gamma. In contrast to hBD-1, -2 and -4, hBD-3 demonstrates a salt-insensitive antimicrobial activity towards several pathogenic microorganisms at physiologic salt concentrations. This makes hBD-3 uniquely and particularly relevant in diseases where other hBDs show inactivity. The ability of hBD-3 to elicit its antimicrobial activity more effectively at the concentrations lower that those of hBD-1 and hBD-2 has been attributed to its amphipathic dimer structure and the increased positive surface charge (+9), compared to hBD-1 (+4) and hBD-2 (+6). hBD-3 has been shown to induce cytokine production from human keratinocytes and stimulates monocyte migration.
Storage -20°C


Previous : hBD - 1, β - Defensin - 1, human Syn-60770 Next : hBD - 4, β - Defensin - 4, human Syn-60772

Click here to leave a message