> Products > Catalog Peptides > Antimicrobial and Related Peptides >

CAP - 18, rabbit Syn-60282

Product Name  
CAP - 18, rabbit
 
Catalog Syn-60282
Sequence
(One-Letter Code)
GLRKRLRKFRNKIKEKLKKIGQKIQGLLPKLAPRTDY
Sequence
(Three-Letter Code)
H - Gly - Leu - Arg - Lys - Arg - Leu - Arg - Lys - Phe - Arg - Asn - Lys - Ile - Lys - Glu - Lys - Leu - Lys - Lys - Ile - Gly - Gln - Lys - Ile - Gln - Gly - Leu - Leu - Pro - Lys - Leu - Ala - Pro - Arg - Thr - Asp - Tyr - OH
Molecular Weight 4433.5
Description This 37 residue peptide is a very effective antimicrobial agent in rabbits. The CAP-18 cathelicidin-derived peptide kills bacteria by disrupting the bacterial membrane. It has a potential for the treatment of bacterial infections in normal and immunocompromised persons and individuals with cystic fibrosis. In experiments it demonstrates the greatest activity against over 20 clinical strains of Pseudomonas aeruginosa. Homologs of CAP18 in other species include humans (FALL39/LL37), mice (mCRAMP), rats (rCRAMP), and sheep (SMAP29 and SMAP34).
Storage -20°C


Previous : Biotin - LC - LL - 37 Syn-60281 Next : Cecropin A Syn-60283

Click here to leave a message