> Products > Catalog Peptides > Amyloid Peptides > Beta-Amyloid (1-43) to (1-49) and (1-55) >

Beta - Amyloid (1 - 55), Human Syn-60158

Product Name  
Beta - Amyloid (1 - 55), Human
 
Catalog Syn-60158
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Thr - Val - Ile - Val - Ile - Thr - Leu - Val - Met - Leu - Lys - Lys - Lys - OH
Molecular Weight 5982.1
Storage -20°C

Previous : Beta - Amyloid (1 - 47), Human Syn-60157 Next : last page

Click here to leave a message