> Products > Catalog Peptides > Amyloid Peptides > Beta-Amyloid (1-42) and Related Peptides >

Beta - Amyloid (1 - 42) - Lys(Biotin) - NH2, Human Syn-60105

Product Name  
Beta - Amyloid (1 - 42) - Lys(Biotin) - NH2, Human
 
Catalog Syn-60105
Sequence
(One-Letter Code)
DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-K(Biotin)-NH2
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Arg - His - Asp - Ser - Gly - Tyr - Glu - Val - His - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - Ile - Ala - Lys(Biotin) - NH2
Molecular Weight 4867.6
Description The difference between this recently released and the previous product (Cat# 23528-01) is the change at the C terminus from a carboxylic acid to an amide. The biological activity should remain the same.
Storage -20°C


Previous : Biotin - LC - beta - Amyloid (1 - 42), Human Syn-60104 Next : Beta - Amyloid (1 - 42) - Lys(Biotin), FAM - labeled, Human Syn-60106

Click here to leave a message