> Products > Catalog Peptides > Amyloid Peptides > Beta-Amyloid (1-40) and Related Peptides >

Beta - Amyloid Peptide (1 - 40), mouse, rat Syn-60043

Product Name  
Beta - Amyloid Peptide (1 - 40), mouse, rat
 
Catalog Syn-60043
Sequence
(One-Letter Code)
DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Sequence
(Three-Letter Code)
H - Asp - Ala - Glu - Phe - Gly - His - Asp - Ser - Gly - Phe - Glu - Val - Arg - His - Gln - Lys - Leu - Val - Phe - Phe - Ala - Glu - Asp - Val - Gly - Ser - Asn - Lys - Gly - Ala - Ile - Ile - Gly - Leu - Met - Val - Gly - Gly - Val - Val - OH
Molecular Weight 4233.8
Storage -20°C


Previous : Beta - Amyloid (1 - 40), sodium salt, Human Syn-60042 Next : Scrambled - beta - Amyloid (1 - 40), Human Syn-60044

Click here to leave a message